Home
Back to Search
DETAILS:

glutamine
>gi|436422|emb|CAA54151.1| glutamine [Brassica napus]
MSLLTDLVNLDLSDNTEKIIAEYIWVGGSGMDMRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEV
ILYPQAIFKDPFRRGNNILVMCDTYTPAGEPIPTNKRHAAAQIFSNPDVVAEVPWYGIEQEYTLLQKDVN
WPVGWPIGGFPGPQGPYYCSVGADKSFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISA
ADEVWIARFILERITEIAGVVVSFDPKPIPGDWNGAGAHTNYSTKSMREEGGYEIIKKAIDKLGLRHKEH
ISAYGEGNERRLTGHHETADINTFKWGVANRGASIRVGRDTEKEGKGYFEDRRPASNMDPYTVTSMIAET
TLLWNP
%
lysine
>gi|14025690|dbj|BAB52290.1| lysine; N6-hydroxylase [Mesorhizobium loti MAFF303099]
MSADLIREPASAGVTPDTTNARTSCHKSGGVDDACGEGKPNGHGRHSLRTASVWERSVGARQLDLSCIGI
GAGPSNLSLACQIHEQIGHGALFLDRQVDFRWHPGSAFESSELQVSHIKDLVTLVNPQSAYTFINYLHEN
GRLYHFLNAQFDAVLRAEFEQYLNWAFRRNPLVRGGETVREIRYDGEFRVRTDDAVLSARDLVVGIGKQA
WIPPQFQGWIGRNLFHSSDLLHIHPEVRQKHVCVVGGGQSGAEVLLHLVGGPRERRPASITWVSQRENYL
PLDNSPFTNELFMPCFSDRFAAMSEPQRKLFLRRFVLASDGISDRTLRAVYQALYRHEFLEPDLCDIALR
PGCNVSRCINAGAGHNLTLQRGLGDVEEVTADIVILATGYENAVPSFLEPMADRLQQTDNELVINADFSV
CWDGPRDRRIFVQNANPGQRGLADPNLSLLAWRARRILDSLLQRAPCANPEHPGFISRTTVESWPDPVAE
EMGSGI
%
proline
>gi|51475427|ref|XP_496493.1| PREDICTED: similar to proline dehydrogenase (oxidase) 1; tumor protein p53 inducible protein 6; p53 induced protein; proline oxidase 2; proline dehydrogenase (proline oxidase ) [Homo sapiens]
MGLIQAFSLLKESVAKMGIASRAEIEDWFTAETLGVSGTVDLLDWSSLIDSRTKLSKHLVVPNGQPGVFL
LGPLPALGGALLFDDWVGPRRAVHWLRWRFRGSVLLVQTGQLEPLLSRFAEEEELQMTRMLQRMDVLPKK
ATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKLLIFNTYQCYLKDAYDNVTLDMELAHREGWCFGA
KPVRGAYLAQERACAAEIGYEDPINPMYEATNTMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRS
TMLTSLPERLDPCRLQLCPCCGWLGSSGELGSPPMGWRSCACILLYFGQLLGMCDQISFPLGEWGPPCSL
VKGARRERQLLWLELLRWLRTGNLFHCPT
%
serine
>gi|82209639|sp|Q7ZVL5|Q7ZVL5_BRARE Serine (Or cysteine) proteinase inhibitor, clade E (Nexin, plasminogen activator inhibitor type 1), member 2
MCVLFRCGVLFLLCSVSVSQSQSSSYGARGSDLGLQVFMQVLQDRAQENVLLSPHGVASVLGMLLPGAHG
DTRRQLLNGLKYKKNGPYKMLRKLHKSLTTKSNADIVTIANALFPNEGFSMKEDFLSANRENFLCESHSV
DYSDPEAAAQSINDWVKNSTKGQIPSVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQSTKPRSFTAGD
GNTYKVPMMSQLSVFNMGQASTPDGQKYIVIELPYHGNSMSMFIALPTEDSTPLSSILPHISTNTIQSWT
KLMNPRRMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRHLSSESIYVSKALQKAKIEVNEDGTK
ASATTSVILHARSSPPWVTVDRPFLFLIRHNSSGTILFAGQINKP
%
valine
>gi|75520419|sp|Q70LM5|LGRC_BREPA Linear gramicidin synthetase subunit C [Includes: ATP-dependent valine adenylase (ValA) (Valine activase); ATP-dependent D-valine adenylase (D-ValA) (D-valine activase); Valine racemase [ATP-hydrolyzing] ; ATP-dependent tryptophan adenylase (TrpA) (Tryptophan activase); ATP-dependent D-leucine adenylase (D-LeuA) (D-leucine activase); Leucine racemase [ATP-hydrolyzing] ; ATP-dependent tryptophan/phenylalanine/tyrosine adenylase (Trp/Phe/TyrA) (Tryptophan/phenylalanine/tyrosine activase); ATP-dependent D-leucine adenylase (D-LeuA) (D-leucine activase); Leucine racemase [ATP-hydrolyzing] ]
MNSMGDLTDLYTLTPLQEGMLFHSLYSEGSAYMIQTTAILTGELDIVPFEKAWKKVIQRHSILRTGFIWE
ETEKPLQAVFESVPFSIRQKDWSSYGSDEQESMLAAFLQNEKAAGFDLSEAPLMRVTIIKLGEAVHRLIW
SFHHLLLDGWSSPIVFQEVLDFYEAYRQGKDLRLPQARPFKDYVSWLRRQDKTASEQFWREFLGPMENPT
PIPFETHAKRTAGHEGLEKQIGEATRALTGQVTKALAKLARTNKVTVNTIVQGAWAILLSRLSGEENVVY
GVTGSGRPSDLPGVEQMVGMFINTLPMKAKIEPEQSLADWFKALQEQQSKVRQYEYTSLVDIQGWTDVPR
GTPLFESIFVFENYPLGEEDEKEVGFTISAVQHFQEVDNPLTVVGIPGDPFSIKMMYATDRFEQAAIERT
LDQLALILEAIVDNPERSLSALSLLRPEERQHLLVGLNDTATNYPSDKTVHQLFAETAARHPERIAAVAG
DQQLTYAELEARANQLANYLQKQGVEAGTLVGLCVDRSLDMLIGLLAILKAGGAYVPIDPAYPEERLAFM
LADAKISILLTQKHLGKQWKGRKRRTVYLDRDAKKWAEESPLAPDVDTTKDSLAYVIYTSGSTGTPKGVL
AVHRGVVRLGQKTRTTSPISEADVFLQASTVSFDAATFEIWGALLNGAKLVLMPPDLPSLDELGEAIVQH
KVTTLWLTAGLFSIMVDHNADYLRGVRQLLVGGDVVSVPHVRKVLALGGVTVINGYGPTENTTFTCCYPV
TELSEDITSFPIGRPISNTTVYVLDKHKQPVPYGAAGELYIGGDGLALGYLNNAELTAERFVENPFDPQK
GSRLYRTGDLVRYLPNGTIEFIGRIDNQVKIRGFRIELGEVEAALALHPEVSETVVMARENDRGEKHLTA
YVTVAKDDAPEVADLQAWLKTKLPEYMVPSAYVFLDAMPLTANGKIDRRRLPEPEWGNRSETKAYTEPRN
QAEELIASIWSQVLGVEKVGIHDNFFELGGHSLLATRVISRLREVFGVEQSVRSIFEHPTIDAWSEQTAA
LQLGGPGTDDSSTQIQPVPRDGALPLSFAQQRLWFFDQLMPDNPMYNIPFALRLQGELDVAAWEKSLQAI
IARHESLRTTFTDIDGQAVQVIHPQLDWKLDTVDLRDRSSEEKQQASARLAADDAARPFDLRQGPLMRAT
MIRTEEQAHVFLINMHHIVSDGWSVGVFLRELFAHYEAYSKGEVPQLAPMPIQYADFAAWQREWLEGEVL
EQQVAYWKEKLGGAEPLLALPTDRPRPALQSYEGATYTTSFSHDLLAKLKKLSKEAQHDLVHDIARRFPN
VLYRYSGQEDIVVGSPVAGRNRQETEKLIGFFVNTLALRTSLSGDLPFTELLARVRETALAAYAHQDVPF
EKLVDELQLERSLSYSQLFQVMFVLQNFPLEDVETAGLHVAPVDTESHLTTSKFDLTLTMREKEDTLVAA
FEYSTDLFDRTTIERMAEHLQHLLASIVTQPEASLDQLALLGESEWNRLVVEQNETATDYPRDKTAHQLF
AETAARYPERIAAVAGDQQLTYAELDTKANQLANYLQKQGVEAGTLVGLCVDRSLDMLVGLLAILKAGGA
YVPLDPAYPEERLAFMLADANVSILLTQKHLGKQWKGRKRRTVYLDRDAKKWTAESPLAPAVDATKDSLA
YVIYTSGSTGTPKGVLVAHRGIVRLVKNTNYVTITEEDVFLQASTVSFDAATFEIWGALLNGAKLVLMPP
DLPSLDELGEAIVQHKVTTLWLTAGLFSIMVDHNADYLRGVRQLLVGGDVVSVPHVRKVLALDGVTVING
YGPTENTTFTCCYPVTELAEEITSFPIGRPISNTTVYVLDKNRQPVPLGVAGELYIGGDGLASGYLNNPE
LTAERFVDNPFDPQKASRLYRTGDLVRYLPDGAIEFIGRIDNQVKIRGFRIELGEIETALLRHPAVQEAF
LMVREDAPGDKRLAAYLVFAGGQTVEPVEMRSYLKDKLPEYMIPSAFVQMDSFPLTPNGKVDRRALPTPE
YARSEAASGYVAPATELEVKLADIWKTVLGVADVGIHDNFFELGGDSILSIQIVARANQLGIRLTPKQLF
ENQTIAELLRVVADSSQLPHTKWENEQGIVTGNVPLTPIQKWFFAADQPSLHHWNQSLLLTVQQPVDVSV
LERAIASLLSHHDALRMSFSFVDGAWTQQMNGLGDHTPFRCVDLSDLSTQEQEQAARLEEIASEVQASLN
IAEGNVVQAVYFNLGEQKAGRLLLVVHHLVVDGVSWRILLEDLQHAYEQLANHADVSFPAKTTSFKMWAE
KLADYADSDALEQEKAYWLQQSSGGSPLPVDHPYEPNENTEAAAKQVTLSLRADETRALLHETLTAYRLQ
INDVLLAALAKAMQRWTGQKTLHVHLEGHGREEIIEGADLSRTVGWFTSMYPVQLDFDQSKPWGHVLKAV
KEQLRHIPQKGIGYGILQYLSNDDEWKEQLQAYTKPEISFNYLGQFDQVVSAGAKFAMAEESRGANIAAD
AIRAHLIDVNSAISGEQLHITWMYNANIHNQETIEALARDYMESLREIMEHCRSEEAGGYTPSDFPLARL
DQRAIDNYVGRDRSIENVYPLTPLQEGMLFHSLYEHAGGDYVVQFSMTMHHVEVDVFQQAWQKVVDRHSI
LRTSFIWDGVSTPHQIVRKHVQVVVDEQDWRHVPADQQKAEWDAFLEEDRKRSFAITEPPLMRWTLLRIS
DTAYRFIWSFHHVLLDGWSVPLVMKDWFAAYMALADGKDIQFGAVHPFSQYVAWIQRQDLQAAERFWRNH
LKGIYAPTQVNFGQTVQPVGETKSYDERSIRFSAERTRELQAFARQHQVTLNTLVQSAWAMILGTYSKEA
DVVFGATGSGRPADLPGVENMVGLFINTLPIRVTLDPGKKVREWLRELQELQVELRQYEYTPLVDIHGWS
EMARNAPLFESIFIFENYPIDESVKEVDHSFQIADVDSVEQTNYPLTVVCGPGAEFLVKIKFDQSRFDGG
RIERVLEQMTLLLQSMTANPDQLLADVNMISQSEQKQVLIEWNETKVDYPTGLCVQQAFEQQVEKTPDAV
ALIYKDVELTYADLNQRANQLAHRLLAQEVKPDTLVGICVERSPEMIIGIFGVMKAGAAYVPIDPALPQE
RIAYMVEDSQASILLTQQSLAELLPKTQARVICLDGDSLANEPVANPASEVTEQNLAYVMYTSGSTGLPK
GVMVEHHSVVNLAHALIEAFRIQPSSRVLQFTSFSFDVSVSEIVMALLAGAALVIEDREVLLPGPELISV
LQQKRITTVSMVSSVLAALPAADLPDLQTLIVGGEAPSRELVARYADRRQFFNCYGPTEATVCSTMMLCN
AGMKSAPIGRPLANATLYVLDANQKPVPVGVPGELYIGGKGLARGYWNRPELTAERFIAHPFGAKGERLY
RTGDLVRYLPDGNLEFLGRIDTQVKIRGYRIELGEIESALSQHPAIQEAVVIAWEQRLAAYMVAAGEAQP
AAEELARYLKETLPDYMIPAGFVFMDAIPLTVNGKVDRRALPAPDWGILATRQEYVAPRTPTEEMVANIW
AQLLSVEKIGVHDDFFERGGHSLLATQAISRLRQAFGVELPLRMLFDHPTTAAISTQIASLLQGETALRS
QPIVPVPRDQHVPLSFAQQRLWFLDRLIPNSFLYNIPSAARLHGELDVEAWERSLKLLIQRHESLRTTFS
DRDGEAVQIIHPAIEWSLGRVDLREWAEAEREAKALQLAIEDAKRPFDLERGPLLRASLLVMAQQEYVFL
LNLHHIVADGWSMNVFMEELVTIYEALSAGETPQLAELPLQYADYAAWQRDWLQGDVLEQQLAYWKAKVG
GAEPLLALPTDRPRPAVQSHKGAMHTITLPAERLAALKTLSREEGSTLFMTLLAAFQTLLYRYSGQSDIV
VGSPVAGRNRQETESLIGFFINTLAMRTDLSGEPTFRDLLGKVRETALEAYAHQDLPFEKLVDELELERS
LSYSPLFQVMFVLQNIPMDAQALSHIRLEPFHIGQEGVSAKFDITLTTVELPAGLMATFEYNTDLFDPAT
IERMAGHYANLLAAVSVNPLQPITAIPLVSDQERKQVLFQWNDTSVPSERDTCVHEQVARIAQQLPNQLA
VVSDEGQITYAELDAKANQVANYLHKQGIISETLVGVCLDRSIDMLVAQLGILKAGGAYVPMDPAYPQER
LAFMMQDAEMPVVLTQEHLLAQLPEARATFLCLDRDWSLIAEESDVAPVIATNRDNLAYVIYTSGSTGTP
KGVEIEHAALLNLVSWHQRAYEVGAEDRATQIAGTAFDASVWEIWPYLTKGATLYLPSEEIRLVPEQLRD
WLVASGITISFLPTPLAERLLTLEWPSDAKLRYMLTGGDKLHDYPPATLPFVLANQYGPTENAVVATAGI
VPAAAGQVSAPSIGRPIDNVQVYVLDEKLQPVPIGVAGELYIAGDSLARGYLHRPDLTRERFIANPYGQK
AGARMYKTGDLVRYLPDGNIEFIGRADDQVSIRGFRVELGEIETALYSHPAVKETIVLVREDMPGMKRLV
AYIVQREGQEGQAVQAGDFRSYLKELLPEYMVPAAFVFMADLPLTPNGKVDRRALPAPDLFNSEADGTYV
APATELEIKLAHIWKNVLGLADVGIHDNFFELGGDSILSIQIVSRANQAGIRLTPKQLLANQTIAELASV
ATVTDESEATKLPNEQGIVTGDVPLTPIQTWFFASEQPSVHHWNQSLLLTVQQPVDLAVLERTIECLLAH
HDALRMRYSRTEQGWTQRIEGLPETIPFRSVDLSAFPTTAEQEMRLEEIASEVQASLDLTEGPVVQAVYF
QLGAEQPGRLLIVAHHLVVDGVSWRILLEDLQTAYEQLAKGQAVQLAAKTTSFKTWAEQLRLYATSEALR
QEKAFWLEQMDEVKPLPIDRIFEPSENTEATVKQVMLSLNAEETRALLQDTLSPYRLQINDVLLAALTKA
LHRWTGEQTVAIHLEGHGREELIEGADLSRTVGWFTSLYPVQLSVDPTKPWGDTLKAVKEQLRSIPNKGV
GYGILRYLSEDAELQKRLAEKAQAEISFNYLGQFDQAVVPESKFGMAQEARGANVGQQAIRQHLLDVNSV
IAGEQLHVTWMYSENIHEEATIQQLAHNYLEALREIIAHGQSEAAGGYTPSDFPLARMDQRALDKYLGQN
RSIENVYPLSPLQGGMLFHSLYEQEGGDYVVQLAMTVEGLDVEAFEQAWQKVVDRHSILRTSFIWEGLTE
PHQVVRKQVKACVEKIDLRHLTPDQQKAELSEYLAADRRRSFEIAVAPLMRWTLFRLSESAYRFTWSFHH
VLLDGWSIPIVLKDWFSAYLSLAEGKEVAHSFVQPFAHYVEWVQRQDLQAAEQFWREQLAGFYEPTPLAM
GNSTGGRADLPKGYEEQEIRLAKDATARLQAFVRTHQLTLNTLVQGAWALMLGRYGGTDDVVFGATGSGR
PADLPGVESMVGLFINTLPIRVALDANQSVREWLRGMQEQQVELRQYEYTPLVDIQGWSEMTRNTALFES
IFIFENYPIGESVKDEQHQLRLSDVETIEQTNYPLTVVCGPGEELIVKIKYEQNRFAPEQIERVLQQMSQ
LLQDMTAKPEQRLQDVSMISERERQQVLVDWNETSVAYPQQLCVHQAFEQQVEKTPDAVALVYKDVELTY
AELNERANQLAHRLLAEGVKPDELVGICVERSPEMIVAFLGVMKAGAAYVPLDPAHPQERIAYMIEDSQA
SVLLTQASLTDRLPASSRQVICLDSDELANEPVTNAETSVGEHNLAYVIYTSGSTGLPKGVMIEHRSVIN
LAYDLIRHFQIDATSRVLQFISFSFDVSVSEIVMSLLAGATLVIEDRESLLPGPELIRVLQEQRITTFAM
VSSVLAALPEADLPDLRTIIVGGEAPSRELVARYATGRQFINCYGPTETTVTATLKHCQDDGKNPPIGRP
IANTTVYVLDAHLQPVPIGVPGELYIGGKGVARGYWNRPELTAERFIADPFGQADERLYRTGDLVRYLEN
GELEFLGRIDDQVKIRGYRIELGEIENALRQHPAVQNVVVIARQEGAGDKRLAAYLVAATGQQPDEAELV
RYLKSTLPEYMVPAGYVWLEKIPLTVNGKVDRRALPAPDYGHAETGKAYVAPRKPIEEIVANIWAQVLSV
ERVGVYDDFFELGGHSLLATQAVSRLKEAFGVNVPLRTLFEHPDVAGMSEKLAGLLEEQSGVTSIPLVPV
PRDKQLPLSFAQQRLWFLDRLMPDSALYNIPSAVRIQGQLNIRAWERSLQTIIERHESLRTTFTDIGGEA
VQVIHEMMEWRLVEIDLRDLPDEEREAAVQRLEKAEASQPFNLRTGPLLRATLIQTGEEDFVFLLNMHHI
VSDGWSMSIFMGELATIYEALSKGDTPQLAEMPLQYADFAAWQRDWLQGEVLEQQLAYWREKLGAAEPML
ALPTDRPRPAVQTHHGALYTTAFPLALTEKLHALSRQEGATLFMTLLAAFQTLLYRYSGQDDIIVGSPVA
GRNKQETESMIGFFINTLAMRTDMSGAPTFRELLARVRDTALEAYTHQDLPFEKLIDELELERSLSYSPL
FQVMFALQNFQMLTREFEGIEIVPFESKNEAVMSKYDISLTMAETQNGLVATFDYNTDLFDHSTIVRMVN
HFHQLLEGIVARPDSSIQALPLLATDEREQLVSAWNNTAAAYTYEQTVHELVAAMAEKMPEQLAVVSAEG
SLTYAQLDAKANQLANYLQQQGITPETLVGICVERSSEMIVGQLGILKAGGAFVPMDPAYPQERLAFMMA
DTGMPFVLTQERLLETLPAGDAAFICLDADWEVIAEESTQAPELAVTTDQLAYVIYTSGSTGTPKGVEIE
HRALLNLIYWHQHAYTITPDDRASQIAGTAFDAAVWEIWPYMTAGATLYLPQEEIRLIPEKLRDWLVAEG
ITISFLPTPLAESMLSVDWPSHAALRYVLTGGDKLHHYPAEHVPFTLVNQYGPTENAVVATAGIVAVQAG
QVTPPSIGRPIDNVQVYILDEQRQPVPIGVTGELYIAGSSLARGYYKRPDLTQERFVDNPFTANRGAKMY
RTGDLVRYLPDGQIEFIGRSDDQVSIRGFRVELGEIESVLYQHPAVKEAIVLAREDMPGVKRLAAYVVVA
EDDAEQADDLRGYLKEKLPEYMVPAAFVTLKALPLTPNGKVDRRALPVPEYTAADGEYVAPETFVEKVLA
QIWKEVLGVEEVGIHDNFFELGGDSILSIQIVARAGQSGIRLSPKLLFENQTIAELSHAVGDSVHICAEQ
GLVTGEVPLLPIQHWFFEQKLADRNHWNQSVLLTVQPIDPEILKQAFYHLLGHHDALRLRFYHQNGAWKQ
AGAEWTDIIPFYVVELGDLPANQQVEQIEKLSGEAQASLHLADGPLLRAVYFDMGAGQEGRLLIVIHHLA
VDGVSWRIITEDLNKACNQLLQGKQVQLPPKTSSYKYWAEKLVEYAASDSLTEEADYWLSRLDTEVAALP
KDYEHGQNRELAARTVSVALTQEETKVLLQELPAVYQTQINDVLLTALAEAVFVWTGNQTTLVHLEGHGR
EDIFDDVDLSRTVGWFTSMYTILLDTRGTSSLTEALQTTKEQLRSIPHKGIGYGILRYLNKETAEKFKSL
PKAQISFNYLGQLDQAVRDTDSLFGFASEARGDNFNRNSDRQHLLDFGCSVVGGQLVVSVAFSKEIYRKE
TIEALADYYITALRQLLAHAKTDKAAAPAQSAASNLSEFGWDDEEIADLLDLIQDK
%
limraz
>ghjgsjghereyutuywetruytryweruwertwueryuwrtweyrtwuewiqiiqqi
%
myfastasasa
>
%
groline
>gfawerhqwgfurgirgyweiurgyweur
%